impurity profile comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Last reviewed on 2026-06-18. Where a claim depends on a specific study, the study is described rather than over-claimed.
Reported purity values can differ between laboratories even for the same sample. Variations arise from column chemistry, mobile-phase composition, gradient slope, detection wavelength, injection load, and integration rules. Area percent also assumes that all species have similar response factors, which is not always true. Method validation examines specificity, linearity, accuracy, precision, limit of detection, and limit of quantitation. When comparing certificates, the method description and representative chromatogram are as important as the headline percentage.
Purity and potency are related but distinct concepts in peptide testing. Purity describes the proportion of the main peptide relative to other detected substances, while potency refers to the biological or functional activity of a defined amount. A highly pure peptide can still have low potency if it is misfolded, aggregated, or chemically modified at a critical residue. Conversely, a less pure preparation may retain high activity if the impurities are inactive. Clear reporting separates these attributes and states the assay used for each.
Handling practices reduce the risk of contamination and degradation. Hygroscopic peptides should be equilibrated to room temperature before opening to prevent condensation on the powder. Weighing and reconstitution in a controlled environment limit exposure to moisture and airborne particles. Aliquotting reconstituted solutions avoids repeated freeze-thaw cycles that can cause aggregation or precipitation. When a purity specification is not met, investigation may consider synthesis byproducts, purification losses, storage conditions, and analytical variability rather than a single cause.
Peptide purity can change during storage, handling, and reconstitution, and lyophilized peptides are generally more stable than solutions because water promotes hydrolysis and aggregation. Residual moisture, oxygen, and trace metals can accelerate degradation even in solid form. Temperature fluctuations during shipping may cause condensation and local moisture uptake. Quality control therefore includes appearance, water content, and analytical testing before and after storage challenges. Peptides containing cysteine, methionine, or tryptophan are especially susceptible to oxidation, while asparagine and glutamine residues can deamidate under neutral or alkaline conditions.
Analytical quality control compares a stored sample against a baseline profile. Reverse-phase chromatography remains common, but stability studies may also use mass spectrometry to detect oxidation, deamidation, or truncation products. Accelerated aging at elevated temperature can reveal degradation pathways, although extrapolation to room temperature is uncertain. Forced degradation studies expose peptides to heat, light, acid, base, and oxidants to identify likely breakdown products. Documentation should record lot number, storage history, and the exact method used for each measurement.
| Property | Value | Notes |
|---|---|---|
| Typical purity specification | 95% or 98% area by RP-HPLC | Grade and application dependent |
| Common identity test | Electrospray ionization mass spectrometry | Confirms molecular mass |
| Typical water content method | Karl Fischer titration | Reports residual moisture |
| Common counterion test | Ion chromatography | Detects trifluoroacetate or acetate |
| Typical validation elements | Specificity, linearity, precision, accuracy | Follows method-validation guidance |
Impurity profiles can include deletion peptides, oxidized forms, truncated sequences, and residual solvents. Some impurities arise during synthesis, cleavage, or purification, while others form during storage. Purity testing often focuses on peptide-related impurities, whereas residual solvents and counterions require separate assays. The significance of a given impurity depends on its amount and properties, which may not be established for a research peptide. Reporting an impurity profile is more informative than reporting a single purity number.
Peptide purity specifications describe the minimum acceptable result from a defined test. A certificate of analysis may list HPLC purity, mass spectrometry identity, appearance, and counterion content. Specifications are method-dependent, so a value obtained with one gradient or wavelength may differ from another. For research use, common thresholds include 95% and 98% by RP-HPLC, but the appropriate limit depends on the application. The specification should always name the analytical method and acceptance criterion.
Chromatographic separation resolves truncated, oxidized, deamidated, and epimerized peptide variants when their retention times differ from the target. Mass spectrometry confirms molecular mass and can reveal modifications that UV detection misses. Liquid chromatography coupled to mass spectrometry combines separation with identity information, which helps distinguish a pure target from a co-eluting impurity. UV-based area percent can overestimate purity if an impurity lacks a chromophore or if the target and impurity have similar response factors. Researchers often report both chromatographic purity and mass confirmation to give a fuller picture.
Additional techniques address components that reversed-phase chromatography may not resolve. Ion-exchange chromatography separates by charge, size-exclusion chromatography detects aggregates, and capillary electrophoresis offers high separation efficiency. Water content is measured by Karl Fischer titration, residual solvents by gas chromatography, and elemental impurities by inductively coupled plasma mass spectrometry. Amino acid analysis or nitrogen determination can estimate peptide content on a mass basis. Purity is frequently reported as area percent, yet standardized comparison across laboratories remains an open question because methods and reporting practices differ.
Peptide purity testing measures how much of a sample consists of the intended peptide sequence compared with related substances, water, counterions, and residual solvents. No single analytical method captures all of these components at once. Reversed-phase high-performance liquid chromatography with ultraviolet detection is widely used because it separates peptides by hydrophobicity. The reported purity value therefore depends on the chosen method, column, mobile phase, and detection wavelength. Established practice treats purity as method-dependent rather than an absolute property of the material.
The therapeutic index (TI) is used to quantify the risks and benefits of a certain drug. It describes the relationship between toxic dose and minimum effective dose, thus providing an important insight into the safety of a drug. The Therapeutic Index is calculated using the following equation: TI = TD50 / ED50, where TD50 is the dose at which toxicity presents in 50% of the population, and ED50 is the dose needed to produce 50% of maximal response. From the equation, a high TI indicates that the drug needs a high dose to induce toxicity in 50% of the population or a low dose to achieve the minimum effective dose, and vice versa. In the case of physiological antagonists, for example, insulin has a narrow TI. A narrow TI indicates that either excess or lack of insulin can cause significant risks. On one hand, lack of insulin may result in high blood glucose levels and kidney or cardiovascular damage. On the other hand, excess insulin may result in insulin-induced hypoglycemia as aforementioned. Another example is dimercaprol, a chemical antagonist in treating metal toxicity. Dimercaprol has a narrow TI so it is replaced by its derivative, 2,3-dimercaptosuccinic acid (DMSA).
Clinical data management Clinical Quality Management System Clinical trial management system Clinical trial Electronic data capture Electronic Common Technical Document (eCTD) Drug development Stuart Summerhayes, CDM Regulations Procedures Manual, Blackwell Publishing, ISBN 1-4051-0740-5 Tai BC, Seldrup J., A review of software for data management, design and analysis of clinical trials, Ann Acad Med Singap. 2000 Sep;29(5):576-81. Greenes RA, Pappalardo AN, Marble CW, Barnett GO., Design and implementation of a clinical data management system, Comput Biomed Res. 1969 Oct;2(5):469-85. CDMS at Mayo Clinic Association for Clinical Data Management Society for Clinical Data Management French network of Data Managers in Academic biomedical research Data Quality Research Institute Data Security Software for Clinics
It has also been discovered that GLD2 has medical uses. For example, such enzyme is overexpressed in patients who suffer from cancer; that's why it can be used as a prognostic factor for early appearance in breast cancer patients. Moreover, PAP activity is used to measure the effect of anticancer drugs as etoposide and cordycepin in two carcinoma cell lines: HeLa, which is the human epithelioid cervix carcinoma, and MCF-7 (human breast cancer). However, in spite its utilities it can also be involved in the expression of several common diseases such as: leukemia, liver cirrhosis, brain injuries, hepatitis and in some cases infertility in male patients.
In 2007, the Alcohol and Tobacco Tax and Trade Bureau (TTB) effectively lifted the long-standing absinthe ban, and it has since approved many brands for sale in the US market. This was made possible partly through the TTB's clarification of the Food and Drug Administration's (FDA) thujone content regulations, which specify that finished food and beverages that contain Artemisia species must be thujone-free. In this context, the TTB considers a product thujone-free if the thujone content is less than 10 ppm (equal to 10 mg/kg). This is verified through the use of gas chromatography–mass spectrometry. The brands Kübler and Lucid and their lawyers did most of the work to get absinthe legalized in the U.S., over the 2004–2007 time period. In the U.S., 5 March sometimes is referred to as "National Absinthe Day", as it was the day the 95-year ban on absinthe was finally lifted. The import, distribution, and sale of absinthe are permitted subject to the following restrictions:
Fermentation is the metabolism of organic compounds in the absence of air. It involves substrate-level phosphorylation in the absence of a respiratory electron transport chain. The equation for the reaction of glucose to form lactic acid is: C6H12O6 + 2 ADP + 2 Pi → 2 CH3CH(OH)COOH + 2 ATP + 2 H2O Anaerobic respiration is respiration in the absence of O2. Prokaryotes can utilize a variety of electron acceptors. These include nitrate, sulfate, and carbon dioxide. In anaerobic organisms and prokaryotes, different pathways result in ATP. ATP is produced in the chloroplasts of green plants in a process similar to oxidative phosphorylation, called photophosphorylation. ATP can also be synthesized through several so-called "replenishment" reactions catalyzed by the enzyme families of nucleoside diphosphate kinases (NDKs), which use other nucleoside triphosphates as a high-energy phosphate donor, and the ATP:guanido-phosphotransferase family.
Sources: en.wikipedia.org
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Acids play important roles in the human body. The hydrochloric acid present in the stomach aids digestion by breaking down large and complex food molecules. Amino acids are required for synthesis of proteins required for growth and repair of body tissues. Fatty acids are also required for growth and repair of body tissues. Nucleic acids are important for the manufacturing of DNA and RNA and transmitting of traits to offspring through genes. Carbonic acid is important for maintenance of pH equilibrium in the body. Human bodies contain a variety of organic and inorganic compounds, among those dicarboxylic acids play an essential role in many biological behaviors. Many of those acids are amino acids, which mainly serve as materials for the synthesis of proteins. Other weak acids serve as buffers with their conjugate bases to keep the body's pH from undergoing large scale changes that would be harmful to cells. The rest of the dicarboxylic acids also participate in the synthesis of various biologically important compounds in human bodies.
The word "aptamer" is a neologism coined by Andrew D. Ellington and Jack Szostak in their first publication on the topic. They did not provide a precise definition, stating "We have termed these individual RNA sequences 'aptamers', from the Latin aptus, to fit." The word itself, however, derives from the Greek word ἅπτω, to connect or fit (as used by Homer (c. 8th century BC)) and μέρος, a component of something larger. A typical aptamer is a synthetically generated ligand exploiting the combinatorial diversity of DNA, RNA, XNA, or peptide to achieve strong, specific binding for a particular target molecule or family of target molecules. Aptamers are occasionally classified as "chemical antibodies" or "antibody mimics". However, most aptamers are small, with a molecular weight of 6-30 kDa, in contrast to the 150 kDa size of antibodies, and contain one binding site rather than the two matching antigen binding regions of a typical antibody.
Catholic Bishops in Kenya are among those who have spread a conspiracy theory asserting that HCG forms part of a covert sterilization program, forcing denials from the Kenyan government. In order to induce a stronger immune response, some versions of human chorionic gonadotropin-based anti-fertility vaccines were designed as conjugates of the β subunit of HCG covalently linked to tetanus toxoid. It was alleged that a non-conjugated tetanus vaccine used in developing countries was laced with a human chorionic gonadotropin-based anti-fertility drug and was distributed as a means of mass sterilization. This charge has been vigorously denied by the World Health Organization (WHO) and UNICEF. Others have argued that an hCG-laced vaccine could not possibly be used for sterilization, since the effects of the anti-fertility vaccines are reversible (requiring booster doses to maintain infertility) and a non-conjugated vaccine is likely to be ineffective. Finally, independent testing of the tetanus vaccine by Kenya's health authorities revealed no traces of the human chorionic gonadotropin hormone.
Motilin has 22 amino acids and molecular weight of 2698 daltons. In extract from human gut and plasma, there are two basic forms of motilin. The first molecular form is the polypeptide of 22 amino acids. The second form, on the other hand, is larger and contains the same 22 amino acids as the first form but includes an additional carboxyl-terminus end. The sequences of amino acids of motilin is: Phe-Val-Pro-Ile-Phe-Thr-Tyr-Gly-Glu-Leu-Gln-Arg-Met-Gln-Glu-Lys-Glu-Arg-Asn-Lys-Gly-Gln. The structure and dynamics of the gastrointestinal peptide hormone motilin have been studied in the presence of isotropic q = 0.5 phospholipid bicelles. The NMR solution structure of the peptide in acidic bicelle solution was determined from 203 NOE-derived distance constraints and six backbone torsion angle constraints. Dynamic properties for the 13Cα→1H vector in Leu-10 were determined for motilin specifically labeled with 13C at this position by analysis of multiple-field relaxation data. The structure reveals an ordered alpha-helical conformation between Glu-9 and Lys-20. The N-terminus is also well structured with a turn resembling that of a classical beta-turn. The 13C dynamics clearly show that motilin tumbles slowly in solution, with a correlation time characteristic of a large object.
Sources: en.wikipedia.org
Purity percentages vary because each laboratory uses its own column, mobile phase, gradient, detection wavelength, and integration settings. A 95% value from one method may not equal 95% from another method. Comparative assessment requires the same validated procedure or an orthogonal cross-check.
A useful certificate of analysis states the peptide sequence, lot number, test methods, acceptance criteria, and measured results. It typically reports HPLC purity, mass spectrometry identity, water content, counterion content, and residual solvents when relevant. The document should also include a chromatogram and the date of testing.
Higher HPLC purity reduces the relative amount of ultraviolet-detectable impurities, but it does not guarantee correct sequence, stereochemistry, or biological activity. Some impurities may be invisible to the chosen method, and aggregates or counterions may still be present. Fitness for purpose depends on the intended application and the full set of tests.
Most lyophilized peptides are stored desiccated at -20 °C or lower, protected from light. Some sequences require -80 °C for long-term stability. Storage recommendations depend on sequence, moisture content, and expected duration.