Everything below concerns charge variants. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Last reviewed on 2026-01-27. Where a claim depends on a specific study, the study is described rather than over-claimed.
Quality control includes system suitability, blank injections, and reference standards. System suitability checks column performance and retention time reproducibility, while blank runs detect carryover or mobile-phase contaminants. Reference standards help calibrate retention time and detector response. Without these controls, a purity value is difficult to compare across laboratories or over time. Documentation of instrument settings and integration parameters is also part of quality control, and acceptance criteria should be set before samples are analyzed.
Impurity profiles can include deletion peptides, oxidized forms, truncated sequences, and residual solvents. Some impurities arise during synthesis, cleavage, or purification, while others form during storage. Purity testing often focuses on peptide-related impurities, whereas residual solvents and counterions require separate assays. The significance of a given impurity depends on its amount and properties, which may not be established for a research peptide. Reporting an impurity profile is more informative than reporting a single purity number.
Reverse-phase high-performance liquid chromatography is the most common primary method for peptide purity testing. The peptide mixture passes through a hydrophobic stationary phase, and components elute according to differences in hydrophobicity. A mobile phase of water and acetonitrile, often with trifluoroacetic acid as an ion-pairing agent, improves peak shape and retention. Ultraviolet detection at 214 nm records the peptide backbone absorbance, and the main peak area is divided by the total peak area to give an area-percent purity value.
Other chromatographic modes provide complementary information that reverse-phase separation may not capture. Ion-exchange chromatography separates peptides by net charge and can resolve deamidated, oxidized, or truncated variants that co-elute under hydrophobic conditions. Size-exclusion chromatography detects aggregates and higher-order oligomers, which are often invisible in reverse-phase assays. Chiral chromatography can quantify D-amino acid epimers when stereochemical purity matters. Because each mode uses a different separation principle, a single purity number from one method cannot describe all possible impurities.
Interpreting chromatographic purity requires attention to detection limits and response factors. Peptides without aromatic residues may absorb weakly at 280 nm, so 214 nm is often preferred, but mobile-phase additives and solvents also absorb at low wavelengths. Co-eluting impurities with different molar absorptivities can produce area percentages that differ from mass percentages. Integration parameters, peak tailing, and baseline choice further affect reported values. For these reasons, method details belong alongside any purity figure, and orthogonal methods are needed to confirm identity and impurity profiles.
| Property | Value | Notes |
|---|---|---|
| Common purity specification | ≥95% by RP-HPLC | Threshold varies by application and supplier |
| Identity confirmation | Mass spectrometry | Expected versus observed molecular mass |
| Appearance | Lyophilized powder | Visual check for color and uniformity |
| Typical storage temperature | -20 °C or lower | Protect from moisture and repeated freeze-thaw |
| Counterion example | Trifluoroacetate or acetate | Residual counterion measured separately |
Mass spectrometry provides complementary information about molecular identity and certain impurities. Electrospray ionization and matrix-assisted laser desorption/ionization are common ionization techniques for peptides. A measured mass close to the expected value supports correct sequence length and modifications, while extra mass signals can reveal truncations, adducts, or incomplete deprotection. Mass spectrometry alone is not a quantitative purity assay, because ionization efficiency varies between compounds. Coupling liquid chromatography to mass spectrometry links retention time with mass and helps assign peaks that ultraviolet detection records.
Orthogonal separation methods address impurities that RP-HPLC may not resolve. Size-exclusion chromatography detects aggregates and higher-order species, while ion-exchange chromatography separates charge variants. Capillary electrophoresis can assess charge-to-mass ratios and, in some formats, size-based impurities. Amino acid analysis and nitrogen determination estimate peptide content rather than chromatographic purity. Because each technique has a different selectivity, a complete purity profile usually combines results from more than one method. The choice of method depends on the impurity classes of concern.
Reversed-phase high-performance liquid chromatography (RP-HPLC) is widely used to estimate peptide purity. Separation depends on interactions between peptide residues and a hydrophobic stationary phase, with gradients of water and organic solvent. Ultraviolet detection near 214 nm responds to the peptide backbone and to many related impurities. The resulting chromatogram is often expressed as area percent, which reports the proportion of peak area assigned to the main component. Different columns, gradients, and wavelengths can produce different purity values for the same material.
Orthogonal methods reduce the chance that a single technique misses an impurity. Capillary electrophoresis separates by charge-to-size ratio and can resolve variants that co-elute under one set of HPLC conditions. Amino acid analysis reports composition after hydrolysis and confirms the presence of expected residues. Karl Fischer titration measures water content, while ion chromatography can quantify counterions. No single number captures all aspects of sample quality, so reports often combine several measurements.
Peptide purity testing uses separation methods to estimate the proportion of a sample that corresponds to the target sequence. Reverse-phase high-performance liquid chromatography is the most common technique, separating peptides by hydrophobicity on a nonpolar column. Ultraviolet detection at 214 nm records peptide bonds and aromatic residues. The resulting chromatogram is reported as area percent, which reflects relative absorbance rather than absolute mass. This distinction matters because water, counterions, and residual solvents do not appear in the peptide peak.
Mass spectrometry provides an identity check that complements chromatographic purity. Electrospray ionization or matrix-assisted laser desorption/ionization measures the mass-to-charge ratio of intact peptides. A match to the expected molecular mass supports correct sequence length and terminal groups. Mass accuracy alone does not prove that every peak in a liquid chromatogram is the target peptide. It also does not directly quantify how much water or counterion remains in a lyophilized powder.
The binding of S-arrestin to rhodopsin is specific and involves changes that occur in rhodopsin after activation. Important serine (Ser) and threonine (Thr) residues in rhodopsin's tail, particularly Thr-340 and Ser-343, are phosphorylated by enzymes called GRKs. These phosphorylated residues strongly attract S-arrestin, helping it bind tightly and effectively shut down rhodopsin's signaling. Additionally, studies of the protein structure have shown that during activation, rhodopsin's transmembrane helix 7 (TM7) and helix 8 change shape. These changes expose a binding site that interacts with a specific part of arrestin called the "finger loop." This interaction, clearly seen in the crystal structure (PDB ID: 4ZWJ), shows how arrestin fits precisely onto activated and phosphorylated rhodopsin, efficiently stopping the visual signal. Arrestin at the U.S. National Library of Medicine Medical Subject Headings (MeSH)
Her research involves structural characterization of biopolymers using mass spectrometry-based techniques, such as liquid chromatography-mass spectrometry, thin-layer chromatography-mass spectrometry, Fourier-transform ion cyclotron resonance mass spectrometry, matrix-assisted laser desorption/ionization time-of-flight mass spectrometry, microfluidic capillary electrophoresis-mass spectrometry, and ion mobility spectrometry-mass spectrometry. She was one of the first scientists to characterize glycoconjugates with tandem mass spectrometry. Her 1988 article has been cited over two thousand times. She participated in the Human Proteome Project, the SysteMHC Atlas project, and the Minimum Information Required for a Glycomics Experiment (MIRAGE) project.
Silver and most silver compounds have an oligodynamic effect and are toxic for bacteria, algae, and fungi in vitro. The antibacterial action of silver is dependent on the silver ion. The effectiveness of silver compounds as an antiseptic is based on the ability of the biologically active silver ion (Ag+) to irreversibly damage key enzyme systems in the cell membranes of pathogens. The antibacterial action of silver has long been known to be enhanced by the presence of an electric field. Applying an electric current across silver electrodes enhances antibiotic action at the anode, likely due to the release of silver into the bacterial culture. The antibacterial action of electrodes coated with silver nanostructures is greatly improved in the presence of an electric field. Silver, used as a topical antiseptic, is incorporated by bacteria it kills. Thus dead bacteria may be the source of silver that may kill additional bacteria.
Sources: en.wikipedia.org
Gary J. Patti is an American biochemist known for his research in metabolism and for using mass spectrometry to characterize biological processes. He is the Michael and Tana Powell Professor at Washington University in St. Louis. He is co-founder and Chief Scientific Officer of Panome Bio and an Associate Editor for Clinical & Translational Metabolism. Biemann Medal, 2024 ACS Midwest Award, 2023 Academy of Science Innovation Award, 2016 Edward Mallinckrodt Jr. Scholar Award, 2016 Pew Biomedical Scholars Award, 2015 Alfred P. Sloan Award, 2014 Camille Dreyfus Teacher-Scholar Award, 2014 Gary Patti publications indexed by Google Scholar
Microscale manipulation and patterning of biological materials such as proteins, cells and tissues have been used in the development of cell-based arrays, microarrays, microfabrication based tissue engineering, and artificial organs. Biological micropatterning can be used for high-throughput single cell analysis, precise control of cellular microenvironment, as well as controlled integration of cells into appropriate multi-cellular architectures to recapitulate in vivo conditions. Photolithography, microcontact printing, selective microfluidic delivery, and self-assembled monolayers are some methods used to pattern biological molecules onto surfaces. Cell micropatterning can be done using microcontact patterning of extracellular matrix proteins, cellular electrophoresis, optical tweezer arrays, dielectrophoresis, and electrochemically active surfaces.
Fetal alcohol spectrum disorders are a group of conditions that can occur in a person whose mother drank alcohol during pregnancy. The most severe form of the condition is known as fetal alcohol syndrome. Problems may include an abnormal appearance, short height, low body weight, small head size, poor coordination, low intelligence, behavior problems, hearing loss, and vision problems. Those affected are more likely to have trouble in school, legal problems, participate in high-risk behaviors, and have trouble with alcohol and recreational drug use. Fetal alcohol syndrome usually occurs when a pregnant woman has more than four drinks per day. Milder symptoms have been found with two drinks per day during the early part of pregnancy. Evidence of harm from less than two drinks per day or 10 drinks per week is not clear. The American Academy of Pediatrics established a conservative set of recommendations in 2015: "During pregnancy: no amount of alcohol intake should be considered safe; there is no safe trimester to drink alcohol; all forms of alcohol, such as beer, wine, and liquor, pose similar risk; and binge drinking poses dose-related risk to the developing fetus." The World Health Organization recommends that alcohol should be avoided entirely during pregnancy, given the relatively unknown effects of even small amounts of alcohol during pregnancy.
AAV is of particular interest to gene therapists due to its apparent limited capacity to induce immune responses in humans, a factor which should positively influence vector transduction efficiency while reducing the risk of any immune-associated pathology. AAV is not considered to have any known role in disease. However, host immune system response and immune tolerance reduce the efficacy of AAV-mediated gene therapy. Host immune response has been shown to respond to the AAV vectors, the transduced cells, and the transduced proteins. The immune response can be subdivided into two categories: innate and adaptive, the latter of which is divided into humoral and cell-mediated.
Sources: en.wikipedia.org
Adalimumab, sold under the brand name Humira and others, is a disease-modifying antirheumatic drug and monoclonal antibody used to treat rheumatoid arthritis, juvenile idiopathic arthritis, psoriatic arthritis, ankylosing spondylitis, Crohn's disease, ulcerative colitis, plaque psoriasis, hidradenitis suppurativa, and uveitis. It is administered by subcutaneous injection (injection under the skin). It works by inactivating tumor necrosis factor (TNF). Common side effects include upper respiratory tract infections, pain at the site of injection, rash, and headache. Other side effects may include serious infections, cancer, anaphylaxis, reactivation of hepatitis B, new onset or exacerbation of demyelinating diseases (such as multiple sclerosis), heart failure, liver failure, and aplastic anemia. Use during pregnancy is not recommended, but some sources show use during breastfeeding may be safe. Adalimumab was approved for medical use in the United States in 2002. It is on the World Health Organization's List of Essential Medicines. It is available as a biosimilar medication. In 2023, it was the 244th most commonly prescribed medication in the United States, with more than 3 million prescriptions.
The ASA is closely related to the concept of the solvent-excluded surface (also known as the Connolly's molecular surface area or simply Connolly surface), which is imagined as a cavity in bulk solvent. It is also calculated in practice via a rolling-ball algorithm developed by Frederic Richards and implemented three-dimensionally by Michael Connolly in 1983 and Tim Richmond in 1984. Connolly spent several more years perfecting the method. Implicit solvation Van der Waals surface VADAR tool for analyzing peptide and protein structures Relative accessible surface area
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Amanda Grace Paulovich is an oncologist, and a pioneer in proteomics using multiple reaction monitoring mass spectrometry to study tailored cancer treatment. Paulovich received a BS in Biological Sciences from Carnegie Mellon University in 1988, a PhD in Genetics from University of Washington in 1996, under the direction of Leland Hartwell. She also received a MD from University of Washington in 1998. Follow her residency in Internal Medicine at Massachusetts General Hospital, she also completed a Postdoctoral Fellowship in Computational Biology at the Massachusetts Institute of Technology Whitehead Center for Genomic Research in 2003, and a Fellowship in Medical Oncology at the Dana Farber Cancer Institute in 2004.
The structures of human P-TEFb containing Cdk9 and cyclin T1 and the HIV Tat•P-TEFb complex have been solved using X-ray crystallography. The first structure solved demonstrated that the two subunits were arranged as has been found in other cyclin dependent kinases. Three amino acid substitutions were inadvertently introduced in the subunits used for the original structure and a subsequent structure determination using the correct sequences demonstrated the same overall structure except for a few significant changes around the active site. The structure of HIV Tat bound to P-TEFb demonstrated that the viral protein forms extensive contacts with the cyclin T1 subunit (Figure 2).
Sources: en.wikipedia.org
It is a document reporting test results for a specific lot, often including appearance, HPLC purity, mass identity, and storage conditions. It should identify the analytical method and acceptance criteria. The certificate describes the tested sample, not necessarily every vial.
Not necessarily. HPLC purity reflects relative ultraviolet absorbance under one set of conditions. A peptide with high area percent may still contain a biologically active impurity or have poor solubility.
Comparisons require the same method, wavelength, gradient, and integration rules. Results from different laboratories may not be directly comparable. Reporting the method alongside the value is essential for interpretation.
HPLC purity measures the relative area of the main peptide peak compared with all detected peaks under one set of separation and detection conditions. It is an operational value rather than an absolute mass fraction. Compounds that do not absorb at the detection wavelength or that co-elute with the main peak are not counted.